AP43589PU-N ALG2 anticorps

See related secondary antibodies

Search for all "ALG2"

0.1 ml / 430,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Vue générale rapide

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog ALG2

Description du Produit ALG2

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, African clawed frog ALG2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Caractéristiques du Produit ALG2

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 ml
Synonymes 3-mannosyltransferase ALG2, Alpha-1, Asparagine-linked glycosylation protein 2, GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase
Presentation Aff - Purified
Reactivité d'Espèce African clawed frog, Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonalité Polyclonal
Hôte Rabbit
Destination Worldwide
Fiche Technique Télécharger la fiche technique
Fournisseur OriGene Technologies GmbH
Material Safety DataSheet (MSDS) MSDS for Polyclonal Antibodies (de)

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
Q9H553
Immunogène:
Synthetic peptide directed towards the C terminal of human ALG2
Séquence AA:
QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC
GeneID:
85365
Applications Western blotting (0.2 - 1.0 µg/ml)
Sujet ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).
Références Générales "A new type of congenital disorders of glycosylation (CDG-Ii) provides new insights into the early steps of dolichol-linked oligosaccharide biosynthesis." Thiel C., Schwarz M., Peng J., Grzmil M., Hasilik M., Braulke T., Kohlschuetter A., von Figura K., Lehle L., Koerner C. J. Biol. Chem. 278:22498-22505(2003)
Stockage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Presentation
Purification:
Purified using peptide immunoaffinity column
Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Reactivité d'Espèce
Species reactivity (expected):
Mouse, Rat, Bovine, Pig, Dog, African clawed frog, Zebrafish
Reactivité d'Espèce (Testé):
Human
ID Gène 85365

Accessory Products

Protéines et/ou Positive Controls

Protéines pour ALG2 (5 produits)

N° du Produit Espèces Presentation Pureté   Source  

ALG2 (transcript variant 1)

ALG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

ALG2

ALG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALG2

ALG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALG2

ALG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALG2

ALG2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive Controls pour ALG2 (2 produits)

N° du Produit Espèces Presentation Pureté   Source  

ALG2 293T Cell Transient Overexpression Lysate(Denatured)

ALG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ALG2 Lysate

Western Blot: ALG2 Lysate [NBL1-07467] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ALG2 Protein
  Novus Biologicals Inc.
  • LinkedIn