discontinued

H00000218-M08 ALDH3 anticorps

See related secondary antibodies

Search for all "ALDH3"

Vue générale rapide

Mouse anti Human ALDH3 2G4

Description du Produit ALDH3

Mouse anti Human ALDH3 2G4.
Presentation: Purified
Product is tested for Enzyme Immunoassay.

Caractéristiques du Produit ALDH3

Type de Produit Anticorps Primaires
Target Category
Quantité 0.1 mg
Synonymes ALDH3A1, ALDHIII, Aldehyde dehydrogenase, Aldehyde dehydrogenase 3, Aldehyde dehydrogenase family 3 member A1, dimeric NADP-preferring
Presentation Purified
Reactivité d'Espèce Hu
Applications E
Clonalité Monoclonal
Clone 2G4
Hôte Mouse
Isotype IgG1
Destination Europe, USA/Canada
Fiche Technique Télécharger la fiche technique
Fournisseur Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Extrait de la Fiche Technique

Immunogène
Swiss Prot:
P30838
Immunogène:
ALDH3A1 (AAH04370, 1 a.a. ~ 454 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Séquence AA:
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAYYEEVVYVLEEIEYMIQ KLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIAAGNAVVLKPSELSENMASLLAT IIPQYLDKDLYPVINGGVPETTELLKERFDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVA CRRIAWGKFMNSGQTCVAPDYILCDPS
GeneID:
218
Remarques:
Gene Accession: BC004370
Isotype Control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant ALDH3A1.

Antibody Reactive Against Recombinant Protein.
Applications ELISA,S-ELISA
Stockage In 1x PBS, pH 7.2
Presentation
Conjugation:
None
Purification:
Purified
Buffer:
In 1x PBS, pH 7.2
Pureté:
Purified
Format:
Purified
Specificité
Espèces:
Human
ID Gène 218

Accessory Products

Protéines et/ou Positive Controls

Protéines pour ALDH3 (9 produits)

N° du Produit Espèces Presentation Pureté   Source  

ALDH3 (transcript variant 2)

ALDH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

ALDH3 (transcript variant 3)

ALDH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

ALDH3 (transcript variant 1)

ALDH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

ALDH3 (1-453, His-tag)

ALDH3 Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / 1 000,00 €
  OriGene Technologies GmbH

ALDH3 (1-453, His-tag)

ALDH3 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / 370,00 €
  OriGene Technologies GmbH

ALDH3

ALDH3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALDH3

ALDH3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALDH3

ALDH3 Human
  Abnova Taiwan Corp.

ALDH3

SDS-Page: ALDH3A1 Protein [NBP1-37091] - ALDH3A1, 52.5 kDa (473aa)  with a purity of 95% by SDS - PAGE
  Novus Biologicals Inc.

Positive Controls pour ALDH3 (4 produits)

N° du Produit Espèces Presentation Pureté   Source  

ALDH3A1 293T Cell Transient Overexpression Lysate(Denatured)

ALDH3A1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ALDH3A1 Lysate

Western Blot: ALDH3A1 Lysate [NBL1-07455] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ALDH3A1 Protein
  Novus Biologicals Inc.

ALDH3A1 overexpression lysate

ALDH3A1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.

ALDH3A1 overexpression lysate

ALDH3A1 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn